PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m013794
Common NameLOC8266360, RCOM_1507300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 526aa    MW: 58433.4 Da    PI: 6.0936
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m013794genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS370.71.9e-1131545251374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykal.ppsetsekn..sseelaalklfsevsPilk 92 
                    lv+lL++cAeav+ +d++ a+alL++l+  a   g+++qR+a++f ++La rl+  ++ ++++ + p  +    +  s+++  al+l +e++P ++
  30147.m013794 154 LVQLLIACAEAVACRDKSHASALLSELRSSALVFGSSFQRVASCFFQGLADRLSLVQPlGTVSLVtPIMNIM--DiaSDKKEEALSLVYEICPHIQ 247
                    689**************************************************9954413444332333444..445999999999********** PP

           GRAS  93 fshltaNqaIleavegeervHiiDfdis....qGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                    f+h++aN+ Ilea+ege+ vH++D++++    +G QW  L+q+La+R+++pp +lRiT+vg        + +++g+ L ++A+ +g+++ef+v v+
  30147.m013794 248 FGHFVANSSILEAFEGESFVHVVDLGMTlglpHGHQWRQLIQSLANRAGKPPcRLRITAVGL----CVGRFQTIGDELVEYAKDVGINLEFSV-VE 338
                    ************************98873333788*************98888*********....**************************9.7* PP

           GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                    ++le+l++++++v  gE+l+Vn++lqlh +++es    +   +vL+++  lsPk++ +veq+++hn++ Fl rf+eal+yysa+fdsl+a lpr +
  30147.m013794 339 STLENLQPDDIKVFDGEVLVVNSILQLHCVVKESRGALN---SVLQTIHALSPKILALVEQDSSHNGPFFLGRFMEALHYYSAIFDSLDAMLPRYD 431
                    *******************************88877777...8***************************************************** PP

           GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      r+k+E++++++ei+n+v+ceg +r+erhe++ +Wr+r+++aGF+++p++  +++qak  l k k  dgy+v ee+g+lvlgWk++p+v++S+W+
  30147.m013794 432 TRRAKMEQFYFAEEIKNIVSCEGPARVERHEKVDQWRRRMSRAGFQAAPVK--MMAQAKQWLGKNKvCDGYTVVEEKGCLVLGWKSKPIVAASCWK 525
                    *************************************************96..789**********9****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.672128506IPR005202Transcription factor GRAS
PfamPF035146.6E-111154525IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MRRRLFPNDL SHDETINETS SLDISLSAMA YYPYPYLPIL ENNESIFVLD FSDETREHKK  60
RIKRALSFAE STGSDGIYNT GGSGSGSGSN DTISRSCSTN SLNSLPRLHF RDHIWTYTQR  120
YLAAEAVEEG AEAMANSEEG ENHGEGGNTD GMRLVQLLIA CAEAVACRDK SHASALLSEL  180
RSSALVFGSS FQRVASCFFQ GLADRLSLVQ PLGTVSLVTP IMNIMDIASD KKEEALSLVY  240
EICPHIQFGH FVANSSILEA FEGESFVHVV DLGMTLGLPH GHQWRQLIQS LANRAGKPPC  300
RLRITAVGLC VGRFQTIGDE LVEYAKDVGI NLEFSVVEST LENLQPDDIK VFDGEVLVVN  360
SILQLHCVVK ESRGALNSVL QTIHALSPKI LALVEQDSSH NGPFFLGRFM EALHYYSAIF  420
DSLDAMLPRY DTRRAKMEQF YFAEEIKNIV SCEGPARVER HEKVDQWRRR MSRAGFQAAP  480
VKMMAQAKQW LGKNKVCDGY TVVEEKGCLV LGWKSKPIVA ASCWKC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-461545254375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4052900.0KM405290.1 Jatropha curcas GRAS32 protein (GRAS32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511245.10.0PREDICTED: DELLA protein RGL1
TrEMBLB9RAM00.0B9RAM0_RICCO; DELLA protein RGL1, putative
STRINGPOPTR_0015s10310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87302945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-79RGA-like 1